DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec4f

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:161 Identity:33/161 - (20%)
Similarity:58/161 - (36%) Gaps:35/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHL 146
            |.:.:.|.|.|::|    |.|.|..|.            :|:......:.|.||...|.....||
Mouse   399 KQEQKTQNQVLQLI----AQNWKYFNG------------NFYYFSRDKKPWREAEKFCTSQGAHL 447

  Fly   147 ANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPF-------FVKWKSNQDTK-- 202
            |::..:.|...::....:..:||.   |.:.|...:.......||       |  |..||...  
Mouse   448 ASVTSQEEQAFLVQTTSSGDHWIG---LTDQGTEGIWRWVDGTPFNNAQSKGF--WGKNQPDNWR 507

  Fly   203 ----KKNQCVYIYAKEMSYDECFEKKSFVCQ 229
                ::..||:: .::.:...|.....:||:
Mouse   508 HRNGEREDCVHV-RQQWNDMACGSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 23/120 (19%)
Clec4fNP_058031.2 DUF2615 <13..93 CDD:402563
SMC_prok_B <83..403 CDD:274008 1/3 (33%)
CLECT_DC-SIGN_like 414..538 CDD:153060 27/142 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.