DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC4A

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:175 Identity:32/175 - (18%)
Similarity:63/175 - (36%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCR 140
            |.|||.|...|:....|:.:.::.... :.:.:...:.::...|..:.|... ..:|.::...|.
Human    73 SQLLEKKTTKELVHTTLECVKKNMPVE-ETAWSCCPKNWKSFSSNCYFISTE-SASWQDSEKDCA 135

  Fly   141 KMNGHLANIQDEMELDGILA-LAPNNSY--------------WIDISKLVENGGTFVSTLTGREP 190
            :|..||..|..:.|.|.|.. |...::|              |:|.:...|: .||         
Human   136 RMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNES-STF--------- 190

  Fly   191 FFVKWKSNQDTKKKNQCVYI----YAKEMSYDE--CFEKKSFVCQ 229
                |...:.:....:||.:    ..|...:::  |...:..||:
Human   191 ----WHPREPSDPNERCVVLNFRKSPKRWGWNDVNCLGPQRSVCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 23/128 (18%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 25/141 (18%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 0/1 (0%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.