DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klri1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001012667.1 Gene:Klri1 / 503651 RGDID:1359344 Length:243 Species:Rattus norvegicus


Alignment Length:110 Identity:27/110 - (24%)
Similarity:45/110 - (40%) Gaps:29/110 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVK 194
            ::|.|:...|.::|.||.:|..:.||:.:|....|.  ||.:.|...|                 
  Rat   149 KSWAESKSACEELNSHLLDIDSKAELENLLLFEING--WILVKKNQTN----------------- 194

  Fly   195 WKSNQ----------DTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            |.|::          |.||.:.|.|:...:...|:|..||.:.|:
  Rat   195 WSSSENETKLQHTLIDEKKNHSCRYLRGSQFIADDCSSKKPYACE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/108 (24%)
Klri1NP_001012667.1 ITIM motif 1. /evidence=ECO:0000250|UniProtKB:P27812 16..21
ITIM motif 2. /evidence=ECO:0000250|UniProtKB:P27812 47..52
CLECT_NK_receptors_like 130..239 CDD:153063 26/108 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.