DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Cd209e

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001178934.1 Gene:Cd209e / 501797 RGDID:1563333 Length:207 Species:Rattus norvegicus


Alignment Length:103 Identity:22/103 - (21%)
Similarity:38/103 - (36%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSY-WIDISKLVENGGTFVSTLTG---REPFF 192
            |..:...|::|...|..|:...|...:...:..|.| |:.:|.|.:.|..:  .|.|   .:...
  Rat    98 WHNSITACQEMEAQLVTIKSPEEQSFLQQTSKKNGYTWMGLSDLNKEGEWY--WLDGSPLSDSLR 160

  Fly   193 VKWKSNQDTKKKNQ-CVYIYAKEMSYDECFEKKSFVCQ 229
            ..|...|......| ||.......:..:|...|.::|:
  Rat   161 NYWNEGQPNNIDGQDCVEFRNDGWNDAKCDNWKFWICK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/101 (21%)
Cd209eNP_001178934.1 CLECT_DC-SIGN_like 77..199 CDD:153060 22/103 (21%)

Return to query results.
Submit another query.