DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and colec10

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:167 Identity:33/167 - (19%)
Similarity:57/167 - (34%) Gaps:55/167 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LKIIMRHHASNIKASNNIKMRRFEKVGSRHFHI---EKNLMQTWFEAYVTCRKMNGHLANIQDEM 153
            |.:.:.|..|::|...|: :....:...::::|   |:|    :.:|...||...|.||..:|: 
 Frog   129 LDVNVAHLKSSLKFVKNV-IAGIRETDEKYYYIVREERN----YRDALTQCRIRGGTLAMPKDQ- 187

  Fly   154 ELDGILALAPNNSYWID-ISKL-----------VENGGTFVSTLTGREPFFVKWKSNQDTKKKNQ 206
                     ..||...| |||:           :|....||.........:..||:.:.....  
 Frog   188 ---------ATNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGS-- 241

  Fly   207 CVYIYAKEMSYDECFEKKS--------------FVCQ 229
                     .|::|.|..|              |||:
 Frog   242 ---------GYEDCVEMLSTGHWNDVDCSLTIYFVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/136 (20%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
CLECT_collectin_like 155..270 CDD:153061 28/140 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.