DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec10a

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_012815686.1 Gene:clec10a / 496661 XenbaseID:XB-GENE-947983 Length:338 Species:Xenopus tropicalis


Alignment Length:112 Identity:26/112 - (23%)
Similarity:46/112 - (41%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDIS------KLVENGGTFVSTLTGREP 190
            |.||...|..::.||..|.:|.|.:.:..:|.....||.::      |.::  ||..:|    .|
 Frog   232 WEEAKKRCEGLSAHLVVINNEDEQEYVFGIAKGQFTWIGLTDSEGEWKWLD--GTPYNT----SP 290

  Fly   191 FFVKWKSNQDTK-------KKNQCVYI-YAKEMSYDECFEKKSFVCQ 229
            .|  |.::|...       ....|.:: |..:.:.|.|..:..|:|:
 Frog   291 KF--WIADQPDNYFGHGLGGGEDCAHLHYNGQWNDDHCSRRYRFICE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/110 (23%)
clec10aXP_012815686.1 PqiB <91..201 CDD:442245
CLECT_DC-SIGN_like 211..336 CDD:153060 26/112 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.