DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Ly49si2

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001009498.1 Gene:Ly49si2 / 494207 RGDID:1359240 Length:267 Species:Rattus norvegicus


Alignment Length:121 Identity:26/121 - (21%)
Similarity:46/121 - (38%) Gaps:30/121 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDIS--------KLVEN 177
            :|.::|   :||......|:|....|..|.||.||..:.....::.|||.:|        ..::|
  Rat   157 YFILDK---KTWIRCQQACQKSRLSLLKIDDEDELKFLQLQVLSDQYWIGLSYNKAKEEWSWIDN 218

  Fly   178 GGTFVSTLTGREPFFVKWKSNQDTKKKNQ----CVYIYAKEMSYDECFEKKSFVCQ 229
            |.:..|.               :.||.|:    |:::....:....|..:...:||
  Rat   219 GQSEFSL---------------NLKKYNEKYGGCMFLSQTRLENAMCMNRYPCICQ 259

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/119 (20%)