DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Ly49s4

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001009487.1 Gene:Ly49s4 / 494195 RGDID:1549723 Length:277 Species:Rattus norvegicus


Alignment Length:231 Identity:41/231 - (17%)
Similarity:72/231 - (31%) Gaps:102/231 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LWDLSGGQQD--IPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASS 77
            |.||...:|:  ....|..|.|||...      |.::.:||.| .:|     ....||::||   
  Rat   112 LLDLINREQNRWYKKTKTVLASPQRTG------GCDEMHWFCY-GIK-----CYYFTMDIRI--- 161

  Fly    78 LLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKM 142
                                                                  |.|...||:  
  Rat   162 ------------------------------------------------------WRECKQTCQ-- 170

  Fly   143 NGHLA----NIQDEMEL--DGILALAPNNSYWIDIS--------KLVENGGTFVSTLTGREPFFV 193
            |..|:    :::||::.  |.|:    .::|||..|        ..::|           .||.:
  Rat   171 NYSLSFLKIDVKDELKFLQDHII----RDNYWIGSSYNNKKKEWSWIDN-----------SPFNL 220

  Fly   194 KWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            .:.:....:|...|:|.....:..|:|.::...:|:
  Rat   221 DFVARNSLRKTGYCMYFSMAGLHDDDCGKRYLCICE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/121 (18%)
Ly49s4NP_001009487.1 Ly49 38..155 CDD:285577 14/54 (26%)
CLECT_NK_receptors_like 142..257 CDD:153063 31/195 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.