Sequence 1: | NP_523512.2 | Gene: | Acp29AB / 34162 | FlyBaseID: | FBgn0015583 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291466.1 | Gene: | colec11 / 492459 | ZFINID: | ZDB-GENE-041114-11 | Length: | 277 | Species: | Danio rerio |
Alignment Length: | 234 | Identity: | 46/234 - (19%) |
---|---|---|---|
Similarity: | 71/234 - (30%) | Gaps: | 91/234 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PNGKATLPSPQTP------QNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQ 84
Fly 85 MEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANI 149
Fly 150 QD---EMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPF--FVKWKSNQDTKKKNQCVY 209
Fly 210 IYAKEMSYD--ECFEKKS--------------FVCQADQ 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Acp29AB | NP_523512.2 | CLECT | 121..229 | CDD:214480 | 29/128 (23%) |
colec11 | XP_009291466.1 | Collagen | 44..102 | CDD:189968 | |
CLECT_collectin_like | 157..272 | CDD:153061 | 33/178 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5252 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |