DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec4a

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:130 Identity:27/130 - (20%)
Similarity:49/130 - (37%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRFEKVGSRHFHIEKNL----MQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNN-SYWIDI 171
            :.::..||..:.:.|:.    ..:|.|:...|..|..||..|..:.|.|.|..:...: :|:|.:
  Rat   109 KNWKPFGSHCYWVTKHTSTYSKASWNESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIGL 173

  Fly   172 SKLVENGGTFVSTLTGREPFFVK---WKSNQDTKKKNQCVYIYAKEMSYD----ECFEKKSFVCQ 229
            .........:||    :.|:...   |...:.:....:||.|......:.    .|..|:..|||
  Rat   174 WDSGHRQWQWVS----QTPYNASATFWHKGEPSSDDEKCVIINHLNSGWGWNDIPCSGKQQSVCQ 234

  Fly   230  229
              Rat   235  234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 23/119 (19%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 27/130 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.