DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CG14866

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001138057.1 Gene:CG14866 / 41854 FlyBaseID:FBgn0038315 Length:455 Species:Drosophila melanogaster


Alignment Length:236 Identity:41/236 - (17%)
Similarity:76/236 - (32%) Gaps:80/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TYNALKQNE--TLAIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIK------ 110
            |:.|:.:|:  .|..|:.:..|:  ..||.:.:...||  :..:|        |.||.|      
  Fly   219 TFRAVSENDLYLLGAIEKLVYRV--DYLESRVRRSEQL--IYYLM--------AGNNQKEVKDPC 271

  Fly   111 MRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPN------NSYWI 169
            ...|.::....::|.......|..|...|:.:|.|||..:...|.:.|:|...|      ..||:
  Fly   272 PANFTRISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEIMAYLLNQPTHRGRDYWL 336

  Fly   170 ------------------------------------DISKLVENGGTFVSTLTGREPFFVKWKSN 198
                                                ..:.||::........||.:..    .:.
  Fly   337 GGLNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANLVDSSEQAAEEATGEDVL----NNT 397

  Fly   199 QDTKKKNQCV----------YIYAKEMSYDECFEKKSFVCQ 229
            ...:.|.:|:          |:|..:    ||..:..::|:
  Fly   398 VQIEGKGRCLRLSYNAGKHSYVYYGQ----ECTSRHYYICE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/159 (15%)
CG14866NP_001138057.1 CLECT 271..434 CDD:214480 25/170 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.