DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and MBL2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:142 Identity:32/142 - (22%)
Similarity:50/142 - (35%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ASNIKASNNIKMRRFEK---------VGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMEL 155
            ||..||... :|.|.:|         ||::.|.....:| |:.:....|.|....:|..::..|.
Human   109 ASERKALQT-EMARIKKWLTFSLGKQVGNKFFLTNGEIM-TFEKVKALCVKFQASVATPRNAAEN 171

  Fly   156 DGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYD 218
            ..|..|....::.....:..|  |.||. |||....:..|...:  :......||.:.......|
Human   172 GAIQNLIKEEAFLGITDEKTE--GQFVD-LTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWND 233

  Fly   219 -ECFEKKSFVCQ 229
             .|......||:
Human   234 VPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/110 (20%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 2/3 (67%)
CLECT_collectin_like 136..246 CDD:153061 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.