DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC12B

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001123470.1 Gene:CLEC12B / 387837 HGNCID:31966 Length:276 Species:Homo sapiens


Alignment Length:247 Identity:49/247 - (19%)
Similarity:90/247 - (36%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLYLLALWNLW--------DLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNE 62
            |:.|:.|..|.        |::...:.:...:.|:...|  .|...|:|.:.|.......||.. 
Human    51 LMLLIGLVTLGMMFLQISNDINSDSEKLSQLQKTIQQQQ--DNLSQQLGNSNNLSMEEEFLKSQ- 112

  Fly    63 TLAIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKN 127
                        .||:|:.:.||.|:|....||   |.|:.:.:...||.::.:  :..::...|
Human   113 ------------ISSVLKRQEQMAIKLCQELII---HTSDHRCNPCPKMWQWYQ--NSCYYFTTN 160

  Fly   128 LMQTWFEAYVTCRKMNGHLANIQDEMELDGILA--LAPNNSYWIDISKLVENGGTFVSTLTGREP 190
            ..:||..:...|...|..|..|....|.|.:::  |...:.:|:.:|          ...:||..
Human   161 EEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLS----------WDSSGRSW 215

  Fly   191 FFVKWKSNQ-------DTKKKNQ------CVYIYAKEMSYDECFEKKSFVCQ 229
            |   |:...       .||:.:|      |.|.....:....|..:..::|:
Human   216 F---WEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/122 (18%)
CLEC12BNP_001123470.1 ITIM motif 5..10
CLECT_NK_receptors_like 143..265 CDD:153063 25/137 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.