DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC2A

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001124183.1 Gene:CLEC2A / 387836 HGNCID:24191 Length:174 Species:Homo sapiens


Alignment Length:58 Identity:13/58 - (22%)
Similarity:25/58 - (43%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLV------ENGGTF 181
            :.|..:.:.|......||.|..:.:::.:...|..:.:||.:|:..      .||.||
Human    77 RNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 13/58 (22%)
CLEC2ANP_001124183.1 predicted transmembrane domain 28..50
predicted extracellular domain 51..174 13/58 (22%)
CLECT_NK_receptors_like 58..169 CDD:153063 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.