DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and tfc

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:57/131 - (43%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGI------LALAPNNSYWIDISKL 174
            |:|.:.:::.......||:|...||....|||:|..:.|.|.:      ..|. :..:||..:.|
  Fly   244 KLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLG-HEHFWISGTDL 307

  Fly   175 VENGGTFVSTLTGREPFFVKWKSNQ------DTKKKNQCVYIY---AKEMSYDE--CFEKKSFVC 228
            .:. |.|....|||...|..|.:.:      :..::..|:.::   .|.:.:::  |..:..|||
  Fly   308 ADE-GNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371

  Fly   229 Q 229
            :
  Fly   372 E 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/124 (22%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 28/126 (22%)

Return to query results.
Submit another query.