DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Colec11

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001414101.1 Gene:Colec11 / 366588 RGDID:1309678 Length:277 Species:Rattus norvegicus


Alignment Length:113 Identity:31/113 - (27%)
Similarity:51/113 - (45%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EAYVTCRKMNGHLANIQDEMELDGILALAPNNSY---------WIDISKLVENGGTFVSTLTGRE 189
            :|.::|:...|.|:..:|| ..:|::|     ||         :|.|:.| |..|.||  .:.|.
  Rat   171 DAQLSCQGRGGTLSMPKDE-AANGLMA-----SYLAQAGLARVFIGINDL-EREGAFV--YSDRS 226

  Fly   190 PF--FVKWKSNQ--DTKKKNQCVYIYAKEMSYD-ECFEKKSFVCQADQ 232
            |.  |.||:|.:  :...:..||.:.|.....| .|.....|:|:.|:
  Rat   227 PMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 29/108 (27%)
Colec11NP_001414101.1 None

Return to query results.
Submit another query.