DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec3a

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001102369.1 Gene:Clec3a / 365009 RGDID:1306295 Length:196 Species:Rattus norvegicus


Alignment Length:50 Identity:12/50 - (24%)
Similarity:23/50 - (46%) Gaps:7/50 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGACLKDEPICIVLDYKFSTDL------NQFLQEHTAETGSLVQ-HNSLR 102
            |||.|....:..:.|.:|.|:.      |::|..|......::: |.:|:
  Rat   251 LGAWLAPVDVKRLHDPRFDTEYKSRGCSNKYLVTHKQSLEDMLEKHQTLQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480
Clec3aNP_001102369.1 CLECT_tetranectin_like 68..193 CDD:153066
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.