DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Cd209d

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209d / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:72 Identity:12/72 - (16%)
Similarity:29/72 - (40%) Gaps:17/72 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGI-----------LALAPNNS----Y 167
            ||.:|..:.  .:.|..:...|:::...|..::.:.|...:           :.|:..::    :
  Rat   115 GSCYFFSKS--QRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWH 177

  Fly   168 WIDISKL 174
            |:|.|.|
  Rat   178 WVDGSPL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 10/69 (14%)
Cd209dNP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 12/72 (17%)

Return to query results.
Submit another query.