DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec4a3

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:119 Identity:27/119 - (22%)
Similarity:43/119 - (36%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MQTWFEAYVTCRKMNGHLANIQDEMELDGI-----------LALA-PNNSYWIDISKLVENG-GT 180
            :::|.|:...|..:..||..|..:.|.|.:           :.|: |.:..|..:.:...|| .|
  Rat   126 VESWMESEEKCSGIGAHLVVIHSQEEQDFLPRILDTHAAYFIGLSDPGHRQWQWVDQTPYNGNAT 190

  Fly   181 FVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKE-----MSYDECFEKKSFVCQ 229
            |             |...:.:....|||.|...|     .|...|.:|:..|||
  Rat   191 F-------------WHEGEPSSDNEQCVIINHHENTGWGWSDSSCSDKQKLVCQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/117 (21%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 25/117 (21%)

Return to query results.
Submit another query.