DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-169

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001023187.2 Gene:clec-169 / 3565430 WormBaseID:WBGene00009526 Length:464 Species:Caenorhabditis elegans


Alignment Length:31 Identity:9/31 - (29%)
Similarity:19/31 - (61%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQNYWFTYNA----LKQNETLAIIDTMEMRI 74
            :|:|:|...:    |:.|.|.|:..|:::|:
 Worm   420 DQSYYFDLGSYSMQLQYNYTSAVEQTIQVRV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480
clec-169NP_001023187.2 CLECT 25..144 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.