DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CG15818

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster


Alignment Length:234 Identity:60/234 - (25%)
Similarity:107/234 - (45%) Gaps:44/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQM---------EIQLQPLKI 94
            |..||.:...|..|.... :|.|.::|.:|.:|.::.::.::.:||.         .|:.:.|:.
  Fly    50 QPVIDHLSKEQQDWGACE-VKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQ 113

  Fly    95 IMRHHASNIKA-SNNIK-------------------------MRRFEKVGSRHFHIEKNLMQTWF 133
            .::....|..| ||.:|                         ::|::::|||:|:||.||...|.
  Fly   114 KLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWR 178

  Fly   134 EAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSN 198
            .|...|.:|.||||..|:..|.:.|:......:||:.::.|.:. |.|:|..:|:...:.||:.|
  Fly   179 TAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQ-GEFISLASGKRATYFKWRKN 242

  Fly   199 QDTKKKN---QCVYIYAKE--MSYDEC-FEKKSFVCQAD 231
             :.|..|   .|.|::..|  |....| .:...|:||:|
  Fly   243 -EPKYNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQSD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 34/113 (30%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.