DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC4G

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_940894.1 Gene:CLEC4G / 339390 HGNCID:24591 Length:293 Species:Homo sapiens


Alignment Length:115 Identity:26/115 - (22%)
Similarity:42/115 - (36%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILAL-APNNSYWIDISKLVENGGTF--VS 183
            |.:.|.   ||..|...|...:.||. |...::..|.|.. .....||:.: :.|.:.|..  ..
Human   179 FSVPKT---TWAAAQDHCADASAHLV-IVGGLDEQGFLTRNTRGRGYWLGL-RAVRHLGKVQGYQ 238

  Fly   184 TLTGREPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYD-EC-FEKKSFVCQ 229
            .:.|....|..|...:  |...:..||.:....:..| .| .||..::|:
Human   239 WVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/113 (22%)
CLEC4GNP_940894.1 Crescentin 70..>154 CDD:437057
CLECT 165..289 CDD:470576 26/115 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.