DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CG2839

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:226 Identity:68/226 - (30%)
Similarity:106/226 - (46%) Gaps:47/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQMEI---QLQPLKIIMRHHASNI 103
            ::.|...|...:|.|....|||..|:|.:|           ...|:   ||:.||:.|..|..::
  Fly    53 LENISEQQKEGYTANFRIFNETQGILDRIE-----------GHQEVNDKQLKALKVKMEGHFMDL 106

  Fly   104 KASNNIKMRR--------------------------------FEKVGSRHFHIEKNLMQTWFEAY 136
            .|...||:::                                |||||||.|:||:::.|.||:|.
  Fly   107 HAKMEIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAM 171

  Fly   137 VTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDT 201
            ..||:|.||||:.|:|.||..|.......|||:|:|.|.:: |.::|.::|.:..|:||...|..
  Fly   172 TKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDH-GQYISLVSGSKAPFLKWNKGQPN 235

  Fly   202 KKKNQCVYIYAKEMSYDECFEKKSFVCQADQ 232
            ::..|||.:........:|..:..|:|||:|
  Fly   236 RENAQCVRVKGGLYQTFQCDHRVLFICQANQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 37/107 (35%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 44/116 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448760
Domainoid 1 1.000 54 1.000 Domainoid score I11184
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22803
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.