DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klri2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_796129.2 Gene:Klri2 / 320407 MGIID:2443965 Length:248 Species:Mus musculus


Alignment Length:112 Identity:30/112 - (26%)
Similarity:50/112 - (44%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFV 182
            |:..:.:.:...:||.|:...|.::|.||..|..:.|::.:|....:.  ||    |....||..
Mouse   140 GNNFYCVFRENSKTWVESQSACEELNSHLVIIDSKAEVENLLLFEMDG--WI----LHRMDGTNS 198

  Fly   183 STLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            |.|.|.:........|...||.:.|.|:.......|||..||:::|:
Mouse   199 SRLWGNDIKIRNTLMNDSEKKNHSCHYLRGNIFMPDECSAKKTYICE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 28/107 (26%)
Klri2NP_796129.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..44
CLECT_NK_receptors_like 132..245 CDD:153063 29/110 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11571
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.