DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp29AB and CD209

DIOPT Version :9

Sequence 1:	NP_523512.2	Gene:	Acp29AB / 34162	FlyBaseID:	FBgn0015583	Length:	234	Species:	Drosophila melanogaster
Sequence 2:	NP_066978.1	Gene:	CD209 / 30835	HGNCID:	1641	Length:	404	Species:	Homo sapiens

Alignment Length:	116	Identity:	20/116 - (17%)
Similarity:	42/116 - (36%)	Gaps:	22/116 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   127 NLMQTWFEAYVTCRKMNGHLANIQ--DEMELDGILALAPNNSYWIDISKLVENG------GTFVS 183
            |..:.|.::...|:::...|..|:  :|.....:.:...|...|:.:|.|.:.|      |:
Human   272 NSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGS--- 333

  Fly   184 TLTGREPFFVKWKSNQDTKKKN-----QCVYIYAKEMSYDECFEKKSFVCQ 229
                  |....:|...:..:.|     .|........:.|:|...|.::|:
Human   334 ------PLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp29AB	NP_523512.2	CLECT	121..229	CDD:214480	19/114 (17%)
CD209	NP_066978.1	Endocytosis signal	14..15
		Endocytosis signal. /evidence=ECO:0000255	16..18
		Endocytosis signal. /evidence=ECO:0000255	31..34
		transmembrane domain	36..59
		PilO	38..>184	CDD:294757
		neck domain	60..249
		CLECT_DC-SIGN_like	256..379	CDD:153060	20/116 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910