DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CD209

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:116 Identity:20/116 - (17%)
Similarity:42/116 - (36%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NLMQTWFEAYVTCRKMNGHLANIQ--DEMELDGILALAPNNSYWIDISKLVENG------GTFVS 183
            |..:.|.::...|:::...|..|:  :|.....:.:...|...|:.:|.|.:.|      |:   
Human   272 NSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGS--- 333

  Fly   184 TLTGREPFFVKWKSNQDTKKKN-----QCVYIYAKEMSYDECFEKKSFVCQ 229
                  |....:|...:..:.|     .|........:.|:|...|.::|:
Human   334 ------PLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 19/114 (17%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
GumC <53..>225 CDD:442439
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 20/116 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.