DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Colec10

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:158 Identity:41/158 - (25%)
Similarity:71/158 - (44%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHI---EKNLMQTWFEAYVTCRKMNGH 145
            |::|.:..||..|: ...|:.|.    :|..|:   :.::|   |||    :.|:...||...|.
  Rat   130 QLDISVARLKTSMK-FIKNVIAG----IRETEE---KFYYIVQEEKN----YRESLTHCRIRGGM 182

  Fly   146 LANIQDEMELDGILA--LAPNNSY--WIDISKLVENGGTFVSTLTGREPF--FVKWKSNQ--DTK 202
            ||..:||: ::.::|  :|.:..:  :|.::.| |..|.:|  .|...|.  :..||..:  |..
  Rat   183 LAMPKDEV-VNTLIADYVAKSGFFRVFIGVNDL-EKEGQYV--FTDNTPLQNYSNWKEGEPSDPY 243

  Fly   203 KKNQCVYIYAKEMSYD-ECFEKKSFVCQ 229
            ....||.:.:.....| ||.....|||:
  Rat   244 GHEDCVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 31/119 (26%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 32/126 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.