DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrc1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001032518.1 Gene:Klrc1 / 29683 RGDID:2976 Length:236 Species:Rattus norvegicus


Alignment Length:110 Identity:19/110 - (17%)
Similarity:38/110 - (34%) Gaps:27/110 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALA----------PNNSYWIDISKLVENGGTFVST 184
            ::|.:...:|...|..|.:|..|.|...:.:.:          ..:..|:     .|||.||   
  Rat   139 KSWNDGLTSCISKNCSLLHIDSEEEQAFLQSFSLVSWTGFFRKSRSQPWV-----WENGSTF--- 195

  Fly   185 LTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
                     |.|..:....:..|:.:....::.:.|.....:||:
  Rat   196 ---------KPKITEMLHDEYNCIMMSTSGLTAENCTILHPYVCK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 18/108 (17%)
Klrc1NP_001032518.1 CLECT_NK_receptors_like 120..232 CDD:153063 19/110 (17%)

Return to query results.
Submit another query.