DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Asgr2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_058885.1 Gene:Asgr2 / 29403 RGDID:2161 Length:301 Species:Rattus norvegicus


Alignment Length:236 Identity:45/236 - (19%)
Similarity:77/236 - (32%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 INQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKA------QMEIQLQPLKIIMRHHASNIKA 105
            :.:.:|    .||  |||:...|      ::|:||||      .....|...:.|:.....:|||
  Rat    84 LQKEFW----TLK--ETLSNFST------TTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKA 136

  Fly   106 SNNIKMRRFEKVGSRHFHIEKNLMQ---------------------------------TWFEAYV 137
            .::..:...     :||.::...:.                                 ||.||..
  Rat   137 DHSTLLFHL-----KHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQ 196

  Fly   138 TCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGRE--PFFVKWKSNQD 200
            .|:..|.||..|....|.:.::........||.   |.:..|:: ..:.|.|  ..|..|...|.
  Rat   197 YCQMENAHLLVINSREEQEFVVKHRGAFHIWIG---LTDKDGSW-KWVDGTEYRSNFKNWAFTQP 257

  Fly   201 TKKKNQCVYIYAKEMSYDECFE-------KKSFVCQADQWA 234
            ...:..      :|...::|.|       ..:|..|.::||
  Rat   258 DNWQGH------EEGGSEDCAEILSDGLWNDNFCQQVNRWA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/149 (17%)
Asgr2NP_058885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Lectin_N 29..162 CDD:397859 19/94 (20%)
CLECT_DC-SIGN_like 170..295 CDD:153060 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.