Sequence 1: | NP_523512.2 | Gene: | Acp29AB / 34162 | FlyBaseID: | FBgn0015583 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058885.1 | Gene: | Asgr2 / 29403 | RGDID: | 2161 | Length: | 301 | Species: | Rattus norvegicus |
Alignment Length: | 236 | Identity: | 45/236 - (19%) |
---|---|---|---|
Similarity: | 77/236 - (32%) | Gaps: | 75/236 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 INQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKA------QMEIQLQPLKIIMRHHASNIKA 105
Fly 106 SNNIKMRRFEKVGSRHFHIEKNLMQ---------------------------------TWFEAYV 137
Fly 138 TCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGRE--PFFVKWKSNQD 200
Fly 201 TKKKNQCVYIYAKEMSYDECFE-------KKSFVCQADQWA 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Acp29AB | NP_523512.2 | CLECT | 121..229 | CDD:214480 | 25/149 (17%) |
Asgr2 | NP_058885.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..29 | ||
Lectin_N | 29..162 | CDD:397859 | 19/94 (20%) | ||
CLECT_DC-SIGN_like | 170..295 | CDD:153060 | 26/133 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |