DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec4a2

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001163804.1 Gene:Clec4a2 / 26888 MGIID:1349412 Length:262 Species:Mus musculus


Alignment Length:118 Identity:23/118 - (19%)
Similarity:43/118 - (36%) Gaps:33/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNS--------------YWIDISKLVENGGTF 181
            :|.::...|.:|..||..||.:.|.|.|..:...::              .|:|.:. .|...||
Mouse   153 SWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTP-YEESITF 216

  Fly   182 VSTLTGREPFFVKWKSNQDTKKKNQC---VYIYAKEMSYDE--CFEKKSFVCQ 229
                         |.:.:.:....:|   :|.:.....:::  |..|:..|||
Mouse   217 -------------WHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/116 (18%)
Clec4a2NP_001163804.1 CLECT_DC-SIGN_like 131..257 CDD:153060 23/118 (19%)

Return to query results.
Submit another query.