| Sequence 1: | NP_523512.2 | Gene: | Acp29AB / 34162 | FlyBaseID: | FBgn0015583 | Length: | 234 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055173.1 | Gene: | CLEC4E / 26253 | HGNCID: | 14555 | Length: | 219 | Species: | Homo sapiens |
| Alignment Length: | 49 | Identity: | 12/49 - (24%) |
|---|---|---|---|
| Similarity: | 20/49 - (40%) | Gaps: | 1/49 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPN-NSYWIDISKLVENG 178 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Acp29AB | NP_523512.2 | CLECT | 121..229 | CDD:214480 | 12/49 (24%) |
| CLEC4E | NP_055173.1 | CLECT_DC-SIGN_like | 80..207 | CDD:153060 | 12/49 (24%) |
| Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 | 169..171 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||