DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC4E

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:49 Identity:12/49 - (24%)
Similarity:20/49 - (40%) Gaps:1/49 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPN-NSYWIDISKLVENG 178
            :|..:...|..|..||..|..:.|.:.:....|. ..::|.:|..|..|
Human   100 SWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 12/49 (24%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 12/49 (24%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.