DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Sftpd

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_037010.1 Gene:Sftpd / 25350 RGDID:3667 Length:374 Species:Rattus norvegicus


Alignment Length:144 Identity:32/144 - (22%)
Similarity:58/144 - (40%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NIKMRRFE----------------KVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELD 156
            |.|::|.|                .||.:.|. ..|..:.:.:|...||:..|.||:.:...|..
  Rat   234 NGKLQRLEAAFSRYKKAALFPDGQSVGDKIFR-AANSEEPFEDAKEMCRQAGGQLASPRSATENA 297

  Fly   157 GI--LALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKW---KSNQDTKKKNQCVYIYAKEMS 216
            .:  |..|.:.:.::.::. |...|.|... ||....:..|   :.|.:...:| ||.|:.....
  Rat   298 AVQQLVTAHSKAAFLSMTD-VGTEGKFTYP-TGEALVYSNWAPGEPNNNGGAEN-CVEIFTNGQW 359

  Fly   217 YDE-CFEKKSFVCQ 229
            .|: |.|::..:|:
  Rat   360 NDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/113 (22%)
SftpdNP_037010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..221
Collagen 41..89 CDD:189968
Collagen 66..124 CDD:189968
Collagen 114..172 CDD:189968
Surfac_D-trimer 223..268 CDD:286141 7/34 (21%)
CLECT 261..374 CDD:295302 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.