DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrd1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_036877.1 Gene:Klrd1 / 25110 RGDID:2978 Length:179 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:44/119 - (36%) Gaps:34/119 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDI------SKLVE 176
            |||.|                |...|..|..:|...||.  ...:....:||.|      |..:.
  Rat    84 GSREF----------------CASQNSSLLQLQTRNELS--FMSSSQAFFWIGIHYNEERSAWLW 130

  Fly   177 NGGTFVSTLTGREPFFVKWKSNQDTKKKNQCV-YIYAKEMSYDECFEKKSFVCQ 229
            ..|||.|  ....|.|.|:       :::.|: |..::|:|.:.|..|..|:|:
  Rat   131 EDGTFPS--KDLFPEFSKF-------RQDHCIGYSISREISSESCENKNRFICK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/114 (22%)
Klrd1NP_036877.1 CLECT_NK_receptors_like 61..176 CDD:153063 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.