DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrd1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_036877.1 Gene:Klrd1 / 25110 RGDID:2978 Length:179 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:44/119 - (36%) Gaps:34/119 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDI------SKLVE 176
            |||.|                |...|..|..:|...||.  ...:....:||.|      |..:.
  Rat    84 GSREF----------------CASQNSSLLQLQTRNELS--FMSSSQAFFWIGIHYNEERSAWLW 130

  Fly   177 NGGTFVSTLTGREPFFVKWKSNQDTKKKNQCV-YIYAKEMSYDECFEKKSFVCQ 229
            ..|||.|  ....|.|.|:       :::.|: |..::|:|.:.|..|..|:|:
  Rat   131 EDGTFPS--KDLFPEFSKF-------RQDHCIGYSISREISSESCENKNRFICK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/114 (22%)
Klrd1NP_036877.1 CLECT_NK_receptors_like 61..176 CDD:153063 29/119 (24%)

Return to query results.
Submit another query.