DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra22

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_775413.2 Gene:Klra22 / 24933 RGDID:3023 Length:265 Species:Rattus norvegicus


Alignment Length:109 Identity:28/109 - (25%)
Similarity:40/109 - (36%) Gaps:23/109 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVK 194
            :||.....||:..:..|..|.||.||..:..|...:||||.:|  .:|.   .|..|        
  Rat   161 KTWSGCTQTCQNFSLPLLTIDDEDELMFLHLLVTPDSYWIGLS--YDNK---KSDWT-------- 212

  Fly   195 WKSNQDTK----------KKNQCVYIYAKEMSYDECFEKKSFVC 228
            |..|..:|          |...||::....:....|....|.:|
  Rat   213 WIDNNPSKLALNTRKYNIKDGGCVFLSKTRLDNINCDNLFSCIC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 28/109 (26%)
Klra22NP_775413.2 Ly49 38..156 CDD:462461
CLECT_NK_receptors_like 143..258 CDD:153063 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.