DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrh1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 / 246043 RGDID:621452 Length:231 Species:Rattus norvegicus


Alignment Length:125 Identity:32/125 - (25%)
Similarity:48/125 - (38%) Gaps:37/125 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVK 194
            :||.|:..:||.:..|||.| |..|....:....|.|||:.:.|   .||.|:            
  Rat   123 KTWDESEASCRLLGSHLAKI-DNREEQNFIQSRLNYSYWVGLRK---KGGQFL------------ 171

  Fly   195 WKSNQDTKKKNQ-------------CVYIYAKEMSYDECFE------KKSFVC--QADQW 233
            |...:|.|..:.             |.||..|.::..:|..      ||:|.|  .::.|
  Rat   172 WVHQEDEKISSDLDFHMTTHLADAACGYIKPKLLNNAQCSRLFPYICKKNFTCLLTSENW 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 31/119 (26%)
Klrh1NP_631926.1 Ly49 36..118 CDD:285577
CLECT_NK_receptors_like 104..220 CDD:153063 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.