DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Mbl1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:158 Identity:33/158 - (20%)
Similarity:64/158 - (40%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SSLLEFK-AQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTC 139
            |..:|.| |.||.::..||       |.::.:|.:......|...:.|.:..:....:.:....|
  Rat    88 SRAIEVKLANMEAEINTLK-------SKLELTNKLHAFSMGKKSGKKFFVTNHERMPFSKVKALC 145

  Fly   140 RKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQ--DTK 202
            .::.|.:|..::..|...|..:|..:::.....::.|  |.|: .:||....:..||.::  |..
  Rat   146 SELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEVTE--GQFM-YVTGGRLTYSNWKKDEPNDHG 207

  Fly   203 KKNQCVYIYAKEMSYD-ECFEKKSFVCQ 229
            ....||.|....:..| .|....:.||:
  Rat   208 SGEDCVTIVDNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/110 (19%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968 33/158 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 22/113 (19%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.