DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Mbl1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:158 Identity:33/158 - (20%)
Similarity:64/158 - (40%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SSLLEFK-AQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTC 139
            |..:|.| |.||.::..||       |.::.:|.:......|...:.|.:..:....:.:....|
  Rat    88 SRAIEVKLANMEAEINTLK-------SKLELTNKLHAFSMGKKSGKKFFVTNHERMPFSKVKALC 145

  Fly   140 RKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQ--DTK 202
            .::.|.:|..::..|...|..:|..:::.....::.|  |.|: .:||....:..||.::  |..
  Rat   146 SELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEVTE--GQFM-YVTGGRLTYSNWKKDEPNDHG 207

  Fly   203 KKNQCVYIYAKEMSYD-ECFEKKSFVCQ 229
            ....||.|....:..| .|....:.||:
  Rat   208 SGEDCVTIVDNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/110 (19%)
Mbl1NP_036731.2 Collagen <36..86 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 22/113 (19%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.