DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-89

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:143 Identity:29/143 - (20%)
Similarity:54/143 - (37%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EKVGSRHFHIEKNLMQTWFEAYVTCRKM----NGHLANIQDEMELDGILALAPNNS--YWIDIS- 172
            ::.|...:|:.:..|:. .||:..|:||    :.|:..::...|.|.|..|...:|  .|||.. 
 Worm    38 DEPGRTCYHLARRRMRL-TEAHSYCQKMIADGSAHVLRVECGGENDFISGLVKGHSEKVWIDARA 101

  Fly   173 --KLVEN-GGTFVSTLTGREPFFV-KWKSNQ----------------DTKKKNQCVYIYAK-EMS 216
              .:|:. .|.|       .|.|| :|.:.:                .:...|:|:.|.:. ...
 Worm   102 RFDIVDGAAGLF-------GPGFVYRWPNGKIVRYSNWANGNGLEEVGSSNSNKCINIKSDGHWM 159

  Fly   217 YDECFEKKSFVCQ 229
            ...|....:.:|:
 Worm   160 NANCSSTAAVICE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/135 (20%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480 28/141 (20%)
CLECT 183..321 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.