DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrh1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001014997.1 Gene:Klrh1 / 232415 MGIID:2685002 Length:223 Species:Mus musculus


Alignment Length:130 Identity:30/130 - (23%)
Similarity:49/130 - (37%) Gaps:37/130 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFV 182
            |..:|..|:.  :||.|:..:|:.:...||.| |..|....:....|.|||:.:.|   .|..| 
Mouse   109 GKCYFFSEEE--KTWDESEASCKVLGSLLAKI-DSREEQNFIQSQVNYSYWVGLHK---KGSQF- 166

  Fly   183 STLTGREPFFVKWKSNQDTKKKN-------------QCVYIYAKEMSYDECFE------KKSFVC 228
                       :|..::|.|..:             :|.||..|.::...|..      |::|.|
Mouse   167 -----------QWVHHKDAKLSSDLDFHTATHVADAECGYIKPKNLNVAPCHRYFYYICKRNFTC 220

  Fly   229  228
            Mouse   221  220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 29/127 (23%)
Klrh1NP_001014997.1 Ly49 31..114 CDD:285577 1/4 (25%)
CLECT_NK_receptors_like 100..216 CDD:153063 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.