DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec12a

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_808354.1 Gene:Clec12a / 232413 MGIID:3040968 Length:267 Species:Mus musculus


Alignment Length:254 Identity:52/254 - (20%)
Similarity:97/254 - (38%) Gaps:75/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QQDIPNGKATLPSPQTPQNTI-----------DQIGINQNYWFTYNALKQNETLAIIDTMEMRIA 75
            :.|...||.:..:..:.|.|:           ..:|:....::|        |||    .|| |.
Mouse    23 KSDKCGGKVSADASHSQQKTVLILILLCLLLFIGMGVLGGIFYT--------TLA----TEM-IK 74

  Fly    76 SSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNI----------------------KMRRFEKVG 118
            |:.|: :|:.|:| :.:.:.::|:.::.|...|:                      |.:...| |
Mouse    75 SNQLQ-RAKEELQ-ENVSLQLKHNLNSSKKIKNLSAMLQSTATQLCRELYSKEPEHKCKPCPK-G 136

  Fly   119 SRHF----HIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGI---------LALAPNNSYWID 170
            |..:    :.:.|...||.|:.:.|...|..|..::::..|:.|         |||.|..    |
Mouse   137 SEWYKDSCYSQLNQYGTWQESVMACSARNASLLKVKNKDVLEFIKYKKLRYFWLALLPRK----D 197

  Fly   171 ISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            .::...:...|:|..:.|        |..|..|| .|.||....:.|..|.::.:.:|:
Mouse   198 RTQYPLSEKMFLSEESER--------STDDIDKK-YCGYIDRVNVYYTYCTDENNIICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/120 (22%)
Clec12aNP_808354.1 ITIM motif 5..10
CLECT_NK_receptors_like 133..247 CDD:153063 29/127 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.