DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Sftpd

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:160 Identity:37/160 - (23%)
Similarity:66/160 - (41%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KAQMEI---QLQPLKIIMRHHASNIKASNNIKMRRF---EKVGSRHFHIEKNLMQTWFEAYVTCR 140
            :.|||.   :||.|::...|:.         |...|   ..||.:.|....: .:.:.:|...|:
Mouse   227 RQQMEALKGKLQRLEVAFSHYQ---------KAALFPDGRSVGDKIFRTADS-EKPFEDAQEMCK 281

  Fly   141 KMNGHLANIQDEMELDGI--LALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKW---KSNQD 200
            :..|.||:.:...|...|  |..|.|.:.::.::. |...|.|... ||....:..|   :.|.:
Mouse   282 QAGGQLASPRSATENAAIQQLITAHNKAAFLSMTD-VGTEGKFTYP-TGEPLVYSNWAPGEPNNN 344

  Fly   201 TKKKNQCVYIYAKEMSYDE-CFEKKSFVCQ 229
            ...:| ||.|:......|: |.|::..:|:
Mouse   345 GGAEN-CVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/113 (22%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
gly_rich_SclB <60..>219 CDD:468478
Surfac_D-trimer 223..267 CDD:286141 12/48 (25%)
CLECT_collectin_like 261..374 CDD:153061 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.