DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Reg2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_033069.1 Gene:Reg2 / 19693 MGIID:97896 Length:173 Species:Mus musculus


Alignment Length:131 Identity:36/131 - (27%)
Similarity:56/131 - (42%) Gaps:37/131 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFHIEKNLMQTWFEAYVTCRKMN-GHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVST 184
            ::.||..|  ||.||.:.|:.|| |||.:         ||:.|.:|.    ::.||:..||..|.
Mouse    55 YYLIEDRL--TWGEADLFCQNMNAGHLVS---------ILSQAESNF----VASLVKESGTTASN 104

  Fly   185 L-TG-REP--------------FFVKWKSN-QDTKKKNQCVYIYA----KEMSYDECFEKKSFVC 228
            : || .:|              .|..|.:. ..|..:..||.:.:    |:...:.|..:.||||
Mouse   105 VWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVC 169

  Fly   229 Q 229
            :
Mouse   170 K 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 35/129 (27%)
Reg2NP_033069.1 CLECT 43..171 CDD:295302 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.