DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-129

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_494582.1 Gene:clec-129 / 189343 WormBaseID:WBGene00021145 Length:211 Species:Caenorhabditis elegans


Alignment Length:126 Identity:29/126 - (23%)
Similarity:47/126 - (37%) Gaps:35/126 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 MRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMEL----DGILA--LAPNNSYWI 169
            ||.||...:.....||           :|:.:...|:.||:..|.    ..:||  ...:.|.|:
 Worm    56 MRVFEGFNAAKTDAEK-----------SCKSVGSTLSGIQNRNEALYIQTALLAQIARSSGSVWV 109

  Fly   170 DISK----LVENGGTFVSTL----------TGREPFFVKWKSNQ-DTKKKNQ-CVYIYAKE 214
            .:.:    |.:......|.|          ||.:.|.  ::.|| |.|:.|| |..:.|.:
 Worm   110 GMQRTQKCLKQPKSDTCSALTAFEYTDGSVTGTDGFI--FQGNQPDNKELNQDCAVLLASK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/116 (22%)
clec-129NP_494582.1 CLECT 40..168 CDD:214480 29/124 (23%)

Return to query results.
Submit another query.