powered by:
Protein Alignment Acp29AB and clec-229
DIOPT Version :9
Sequence 1: | NP_523512.2 |
Gene: | Acp29AB / 34162 |
FlyBaseID: | FBgn0015583 |
Length: | 234 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506804.2 |
Gene: | clec-229 / 186672 |
WormBaseID: | WBGene00010355 |
Length: | 188 |
Species: | Caenorhabditis elegans |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 17/36 - (47%) |
Gaps: | 4/36 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 IQDEME-LDGILALAPNNSYWIDISKLVENGGTFVS 183
:.|..| |:|: :.||:...|...|.:..|..||
Worm 129 VTDPYEWLNGV---STNNALANDFMPLYDGSGDCVS 161
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acp29AB | NP_523512.2 |
CLECT |
121..229 |
CDD:214480 |
11/36 (31%) |
clec-229 | NP_506804.2 |
CLECT |
45..183 |
CDD:214480 |
11/36 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1201127at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.