DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-241

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001343584.1 Gene:clec-241 / 186070 WormBaseID:WBGene00009906 Length:212 Species:Caenorhabditis elegans


Alignment Length:105 Identity:24/105 - (22%)
Similarity:38/105 - (36%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CRKMNGHLANIQDEMELD----GILAL-APNNSYWIDISK---LVENGGTFVST----------- 184
            |......|::||.:.|||    ..:|| ..::::||...:   .:.:|.|...|           
 Worm    97 CSSEGAVLSSIQSQEELDYMANSFIALNGASSAFWIGAERTAACMSSGLTATCTRLNSFSWTDGS 161

  Fly   185 LTGREPFFVKW---KSNQDTKKKNQCVY-IYAKEMSYDEC 220
            .||...|.  |   :.|........||. .|...:|..:|
 Worm   162 ATGTAGFV--WNGIEPNNGAGMTESCVVENYMALLSDQQC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/105 (23%)
clec-241NP_001343584.1 CLECT 79..210 CDD:153057 24/105 (23%)

Return to query results.
Submit another query.