powered by:
Protein Alignment Acp29AB and clec-231
DIOPT Version :9
Sequence 1: | NP_523512.2 |
Gene: | Acp29AB / 34162 |
FlyBaseID: | FBgn0015583 |
Length: | 234 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506808.2 |
Gene: | clec-231 / 183005 |
WormBaseID: | WBGene00007805 |
Length: | 174 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 8/43 - (18%) |
Similarity: | 15/43 - (34%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 WNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTY 55
|.|..|......:..|...:..|:.| :..:.:....||.:
Worm 3 WRLTVLFFASAQLSEGCLPMVPPEEP---VTPVPVCPAGWFQF 42
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acp29AB | NP_523512.2 |
CLECT |
121..229 |
CDD:214480 |
|
clec-231 | NP_506808.2 |
CLECT |
35..169 |
CDD:214480 |
2/8 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1201127at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.