DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-50

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_507830.1 Gene:clec-50 / 180299 WormBaseID:WBGene00012253 Length:321 Species:Caenorhabditis elegans


Alignment Length:129 Identity:31/129 - (24%)
Similarity:53/129 - (41%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALA--------PNNSYWIDISKLVE 176
            |.:|..|     |.:|...|..:..||.::..|.|...:..||        |.:..||.:.|:  
 Worm   197 RVYHNAK-----WEDAEAACVLLGAHLTSVHSETENTFVANLASCGIKEGNPKDLAWIGMHKV-- 254

  Fly   177 NGGTFVSTLTGREPFFVKWKSNQ-DTKKKNQCVYIYAKEMSYDECFEK----------KSFVCQ 229
             |..:|.| .|....::.|...| |...|..||.. |.::|:|:.:|.          ::::|:
 Worm   255 -GQDWVWT-DGTPSNYINWAPKQPDNPGKENCVET-APDLSHDKWYENWNNEACSTEMRAYICK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 29/126 (23%)
clec-50NP_507830.1 CLECT 26..146 CDD:214480
CLECT 182..315 CDD:214480 30/127 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.