DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-49

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_507829.1 Gene:clec-49 / 180298 WormBaseID:WBGene00012251 Length:321 Species:Caenorhabditis elegans


Alignment Length:34 Identity:12/34 - (35%)
Similarity:13/34 - (38%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GACLKDEPICIVLDYKFSTDLNQFLQEHTAETGS 94
            |.|..|  |.|.||....|.....:.||...|.|
 Worm   237 GTCAND--IAIKLDCDEVTGCKDIVMEHINITSS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480
clec-49NP_507829.1 CLECT 31..146 CDD:214480
CLECT 182..315 CDD:214480 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.