DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-208

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_503569.1 Gene:clec-208 / 178689 WormBaseID:WBGene00018097 Length:223 Species:Caenorhabditis elegans


Alignment Length:85 Identity:19/85 - (22%)
Similarity:29/85 - (34%) Gaps:37/85 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CRKMNGHLANIQDEMELDGILA-----LAP----------------------------NNSYWID 170
            |....|.|:.:|:..|::.|::     ::|                            |:.||.|
 Worm    83 CATHGGVLSGMQNVEEINYIVSQSVRLISPEVSGGVWVGARRRPACISSGITATCTKTNSFYWTD 147

  Fly   171 ISKLVENGGTFVSTLTGREP 190
            ||....||..|    |..||
 Worm   148 ISATGINGMLF----TDGEP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 19/85 (22%)
clec-208NP_503569.1 CLECT 65..219 CDD:153057 19/85 (22%)

Return to query results.
Submit another query.