DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-207

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_503568.1 Gene:clec-207 / 178688 WormBaseID:WBGene00018096 Length:223 Species:Caenorhabditis elegans


Alignment Length:105 Identity:21/105 - (20%)
Similarity:33/105 - (31%) Gaps:43/105 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CRKMNGHLANIQDEMELDGILA-----LAP----------------------------NNSYWID 170
            |....|.|:.:|:..|::.|::     ::|                            |:.||.|
 Worm    83 CATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACISSGITATCTKTNSFYWTD 147

  Fly   171 ISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYI 210
            .|....||..|    |..||      :|...|....|..:
 Worm   148 NSATGINGMLF----TNGEP------NNGGVKLDQDCALL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/105 (20%)
clec-207NP_503568.1 CLECT 65..219 CDD:153057 21/105 (20%)

Return to query results.
Submit another query.