DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-186

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_502450.2 Gene:clec-186 / 178238 WormBaseID:WBGene00014138 Length:353 Species:Caenorhabditis elegans


Alignment Length:145 Identity:30/145 - (20%)
Similarity:51/145 - (35%) Gaps:37/145 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EKVGSRHFHIEKNLMQTWFEAYVT-----------CRKMNGHLANIQDEMELDGILALAP----- 163
            |:...||.|  :..:.|...|:|:           |......||.:.:.:..:.:.:.|.     
 Worm    18 EEASCRHPH--ERFIGTRCYAFVSKKHTYNTAKEYCDSHGYSLATVDNAITSNFLASSAATEFGS 80

  Fly   164 -NNSYWIDISKLVE------NGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECF 221
             |..:||.:|:..:      :.||.||...    |...:.:.||...:|      .:...:....
 Worm    81 NNGQFWIGLSRKKDYELFNWDDGTIVSYTN----FEAGFPNKQDFVAEN------VRNGRWQTLA 135

  Fly   222 EKK--SFVCQADQWA 234
            |.|  .|||..|..|
 Worm   136 EHKELEFVCSYDPTA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/132 (19%)
clec-186NP_502450.2 CLECT 31..144 CDD:214480 22/122 (18%)
CLECT 211..349 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.