DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-67

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_500437.2 Gene:clec-67 / 177151 WormBaseID:WBGene00018971 Length:467 Species:Caenorhabditis elegans


Alignment Length:100 Identity:21/100 - (21%)
Similarity:34/100 - (34%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQMEIQLQPLK 93
            |||.|:..|..|....:|..|...|.|:    |:.          :.|.:|...:...:..||:.
 Worm   155 KATTPTTTTAANVNCPLGGQQTVLFAYS----NDL----------VPSVVLNTFSSSYLNSQPVT 205

  Fly    94 IIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNL 128
            |.:    |.........|..|......:.::..||
 Worm   206 IAI----SRFDTRQPQSMMYFNDYNQAYSYLSTNL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 1/7 (14%)
clec-67NP_500437.2 Lectin_C 38..145 CDD:459655
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.